PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.003G359800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 293aa    MW: 32375.6 Da    PI: 8.7494
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.003G359800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.32.6e-113380247
                          SSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding  2 grWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqky 47
                          ++WT+eE +++ +a ++   +   +W+++a+ ++ ++t+ +++++++++
  Sobic.003G359800.1.p 33 DAWTAEENKKFEKALALIDRNapdRWEKVAELLP-RKTADDVRNHYHDL 80
                          58*****************99*************.***********976 PP

2Myb_DNA-binding47.54.1e-15143187347
                           SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                           +WT+eE++l++ + k++G g+W+ I+r+  ++Rt+ q+ s+ qky
  Sobic.003G359800.1.p 143 PWTEEEHKLFLMGLKKYGRGDWRNISRKYVTTRTPTQVASHAQKY 187
                           8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.7493083IPR017884SANT domain
SMARTSM007172.1E-93183IPR001005SANT/Myb domain
SuperFamilySSF466891.94E-113388IPR009057Homeodomain-like
CDDcd001672.54E-83480No hitNo description
PfamPF002492.5E-93480IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.4E-73479IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.5E-12134188IPR009057Homeodomain-like
PROSITE profilePS5129418.021136192IPR017930Myb domain
SuperFamilySSF466891.29E-17138192IPR009057Homeodomain-like
TIGRFAMsTIGR015575.2E-17139190IPR006447Myb domain, plants
SMARTSM007176.0E-13140190IPR001005SANT/Myb domain
CDDcd001671.70E-11143188No hitNo description
PfamPF002491.4E-12143187IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MMAEAAWTPV LFPPTVPCFW QPDTHPVFWR RGDAWTAEEN KKFEKALALI DRNAPDRWEK  60
VAELLPRKTA DDVRNHYHDL ENDVGYIEAG LVPFPHYSSS VPSSGFTLED WDAYGGGGGG  120
FRRGGYCLKR SRGSDQERKK GVPWTEEEHK LFLMGLKKYG RGDWRNISRK YVTTRTPTQV  180
ASHAQKYFIR LNSGGKDKRR SSIHDITTVN LPDEDRGNAT PPSPPSAVTA ANPSVAALVD  240
VKPFMAPLPA GALGGVTHPY VNVKLEPKSS LVAGLGLGFD DSVFLQMHCG QL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A4e-1732100876RADIALIS
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sbi.17520.0embryo| panicle| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794441e-140HF679444.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB38 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002458779.11e-175hypothetical protein SORBIDRAFT_03g040160
SwissprotQ8S9H79e-80DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLC5XPW21e-175C5XPW2_SORBI; Putative uncharacterized protein Sb03g040160
STRINGSb03g040160.11e-175(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22743796
Representative plantOGRP27517122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58900.15e-75Homeodomain-like transcriptional regulator